Sunday, 7 March 2021

TAILOROFDEATHmp3.MP4


 

FRANKINSTEINTHEPIEEYEDPIPER.MP4


 

New Species Newsletter 7-3-2921-Number 2

 

Newly discovered millipede, Nannaria hokie, lives at Virginia Tech

Science Daily

Hearing the words "new species discovered" may conjure images of deep caves, uncharted rainforests, or hidden oases in the desert. But the reality is ...

Flag as irrelevant

China's new laws overlook native herpetofauna

Science Magazine

All species that are newly discovered or recorded or have experienced recent changes in species-level taxonomy are excluded from protection until the ...

Flag as irrelevant

Archeologists Discover One Of The Oldest Unknown Species In Argentina

tntribune.com

The last new species was discovered in 1998,” said an expert. This new species is believed to have lived three million years before the world's oldest ...

Flag as irrelevant

Primate ancestor of all humans likely roamed with the dinosaurs

Livescience.com

Scientists have identified the earliest primate fossils: tiny ancient teeth from a ... The five fossils in the new study belong to a genus called Purgatorius ... three teeth have been assigned to a new species named Purgatorius mckeeveri.

Flag as irrelevant

Scientists discover three glow-in-the-dark sharks

Mongabay.com

Researchers have discovered that three deep-sea shark species — the kitefin ... “For the moment … our conclusion is that, maybe sharks have a new ...

Flag as irrelevant

Scientists discover how microorganisms evolve cooperative behaviors

Science Daily

... new window to understand the key roles of these interactions in industrial applications, and in the health and disease of humans, animals and plants ...

Flag as irrelevant

Could catnip become the new insect repellent?

Science Daily

"We discovered that Catnip and its active ingredient Nepetalactone activate the irritant receptor TRPA1, an ancient pain receptor found in animals as ...

Flag as irrelevant

Glow-In-The-Dark Sharks Discovered off the Coast of New Zealand

Euro Weekly News

In a bizarre discovery scientists have found that three species of sharks can actually glow-in-the-dark. They are all deepwater sharks, and the find ...

Flag as irrelevant

More butterflies as Hong Kong's temperature rises

Hong Kong Standard

Green Power announced a survey today about newly discovered butterflies and their relationship to rising temperatures. Five new species were ...

Flag as irrelevant

Sharks that glow in the dark discovered off NZ coast

ABC News

Scientists studying marine life off New Zealand's east coast have observed three shark species that glow in the dark. Bioluminescence is a common ...

Superman adventure with Batman


 

New Species Newletter 7-03-2021

 

NEWS

Largest Glowing Shark Species Discovered Near New Zealand

The New York Times

Largest Glowing Shark Species Discovered Near New Zealand. It's the biggest bioluminescent vertebrate found on land or sea, so far.

Flag as irrelevant

Five new shrub frog species have been discovered in the Western Ghats as part of a decade long ...

Firstpost

Researchers said the new species were identified and found to be distinct based on multiple criteria, such as their external morphology, DNA, calling ...

Flag as irrelevant

This deep-sea shark is one of the world's largest glowing animals

National Geographic

A new study has found that three species of deep-sea shark, including the six-foot-long kitefin shark, are bioluminescent. ByAnnie Roth. Published ...

Flag as irrelevant

New species of millipede — Nannaria hokie — found at Virginia Tech

WFXRtv.com

New species are discovered each year by scientists around the world. However, a new species has been found in Virginia Tech's backyard. AddThis ...

Flag as irrelevant

Meet the newest member of the Hokie nation: The Nannaria hokie

WDBJ7

Scientists say this new species shows a discovery can be found not just in far exotic places, but also in our hometowns. Copyright 2021 WDBJ. All rights ...

Flag as irrelevant

Scientist Discovers Tiny Fish the Size of a Pill, Names It After the Pandemic

Newsweek

Blennies are a group of over 900 small reef fish species, which are found around the world. The name of the new blenny species was inspired by ...

Flag as irrelevant

THE WIERD DOCTOR STANGE JOURNEY


 

GHOSTMAN HORROR THE GHIST THAT STOLE A BODY


 

Bizarre-But-True-Lazarus-Syndrome