Sunday, 7 March 2021

Beyond-Midnight-The-Visits.MP4


 

Beyond-Midnight-The-Room.MP4


 

Beyond-Midnight-The-Signalman.MP4


 

TAILOROFDEATHmp3.MP4


 

FRANKINSTEINTHEPIEEYEDPIPER.MP4


 

New Species Newsletter 7-3-2921-Number 2

 

Newly discovered millipede, Nannaria hokie, lives at Virginia Tech

Science Daily

Hearing the words "new species discovered" may conjure images of deep caves, uncharted rainforests, or hidden oases in the desert. But the reality is ...

Flag as irrelevant

China's new laws overlook native herpetofauna

Science Magazine

All species that are newly discovered or recorded or have experienced recent changes in species-level taxonomy are excluded from protection until the ...

Flag as irrelevant

Archeologists Discover One Of The Oldest Unknown Species In Argentina

tntribune.com

The last new species was discovered in 1998,” said an expert. This new species is believed to have lived three million years before the world's oldest ...

Flag as irrelevant

Primate ancestor of all humans likely roamed with the dinosaurs

Livescience.com

Scientists have identified the earliest primate fossils: tiny ancient teeth from a ... The five fossils in the new study belong to a genus called Purgatorius ... three teeth have been assigned to a new species named Purgatorius mckeeveri.

Flag as irrelevant

Scientists discover three glow-in-the-dark sharks

Mongabay.com

Researchers have discovered that three deep-sea shark species — the kitefin ... “For the moment … our conclusion is that, maybe sharks have a new ...

Flag as irrelevant

Scientists discover how microorganisms evolve cooperative behaviors

Science Daily

... new window to understand the key roles of these interactions in industrial applications, and in the health and disease of humans, animals and plants ...

Flag as irrelevant

Could catnip become the new insect repellent?

Science Daily

"We discovered that Catnip and its active ingredient Nepetalactone activate the irritant receptor TRPA1, an ancient pain receptor found in animals as ...

Flag as irrelevant

Glow-In-The-Dark Sharks Discovered off the Coast of New Zealand

Euro Weekly News

In a bizarre discovery scientists have found that three species of sharks can actually glow-in-the-dark. They are all deepwater sharks, and the find ...

Flag as irrelevant

More butterflies as Hong Kong's temperature rises

Hong Kong Standard

Green Power announced a survey today about newly discovered butterflies and their relationship to rising temperatures. Five new species were ...

Flag as irrelevant

Sharks that glow in the dark discovered off NZ coast

ABC News

Scientists studying marine life off New Zealand's east coast have observed three shark species that glow in the dark. Bioluminescence is a common ...

Superman adventure with Batman


 

New Species Newletter 7-03-2021

 

NEWS

Largest Glowing Shark Species Discovered Near New Zealand

The New York Times

Largest Glowing Shark Species Discovered Near New Zealand. It's the biggest bioluminescent vertebrate found on land or sea, so far.

Flag as irrelevant

Five new shrub frog species have been discovered in the Western Ghats as part of a decade long ...

Firstpost

Researchers said the new species were identified and found to be distinct based on multiple criteria, such as their external morphology, DNA, calling ...

Flag as irrelevant

This deep-sea shark is one of the world's largest glowing animals

National Geographic

A new study has found that three species of deep-sea shark, including the six-foot-long kitefin shark, are bioluminescent. ByAnnie Roth. Published ...

Flag as irrelevant

New species of millipede — Nannaria hokie — found at Virginia Tech

WFXRtv.com

New species are discovered each year by scientists around the world. However, a new species has been found in Virginia Tech's backyard. AddThis ...

Flag as irrelevant

Meet the newest member of the Hokie nation: The Nannaria hokie

WDBJ7

Scientists say this new species shows a discovery can be found not just in far exotic places, but also in our hometowns. Copyright 2021 WDBJ. All rights ...

Flag as irrelevant

Scientist Discovers Tiny Fish the Size of a Pill, Names It After the Pandemic

Newsweek

Blennies are a group of over 900 small reef fish species, which are found around the world. The name of the new blenny species was inspired by ...

Flag as irrelevant

THE WIERD DOCTOR STANGE JOURNEY


 

GHOSTMAN HORROR THE GHIST THAT STOLE A BODY


 

Saturday, 6 March 2021

Joyce M. Johnson -AUTHOR-Actor

 






Joyce M. Johnson was born in Jamaica West Indies where she spent her formative years and has lived in Canada for over 50 years where she attended high school and college. After graduating from college, her long successful career began at Dover Elevator where she worked in main frame computer as Operation and Programmer.  Joyce studied creative writing at Seneca College, Toronto, Canada.

The years of living in Canada have awakened Joyce’s consciousness. She been led by inner and outward influences to engage in social dialoguing at the ‘community level’ as to write about and share her wealth of experiences developed in Canada. Shaped  in part by her Jamaican past.  Her first novel was called, In ‘Search Of Happiness’. The name has been  change to ‘Henrietha’, It is sequel”, which is now completed after writing for many years. Also I have completed another sequel novel called, “Waiting For The World To Change”.    Joyce says. “This is an exciting beginning to my writing career, because I do feel this is where my calling lies. “Henrietha – and Waiting For the Word was published but decided to pulled it and do some more editing on the novels.

Synopsis 

These books are focused on the sexual abuse of young girls in the African American community and the lack of appropriate father figures. Henrietha and Joanna, who is a journalist, are old friends who meet up multiple times while Henrietha tells stories of her own childhood and adulthood victories and abuses, Henrietha recalls not just her own sufferings but also those of her child, Melinda-Sue and granddaughter Ruth. After Ruth’s biological father lands in jail, Melinda-Sue finds herself getting married to Jason, who then sexually abuses Ruth from the tender age of five years old, for seven years. Ruthie comes to live with her grandmother after being abused sexually by both her biological father and her stepfather who then kicked her out of the house. Henrietha and Joanna share their fair shares of challenges in life as they continue to catch up with each other after some time apart.

 

The stories shared in the book covered a wide range of themes. Those themes included gender, power, race, religion, love, guilt, stigma, and class. You can expect to imagine vivid pictures of the events they recalled; almost like you were there with them. Although their stories were engulfed in sadness, they added a twist of humor occasionally to lighten up the reader from the darkness of the tales.



Book BLURB

Ruthie often traveled on the subway with her best friend Jem from the church where they attend often. She told me that the pastor had brainwashed her. When the abused came to light to her pastor, he called her stepfather and setup a counsel session for him but not for Ruthie.

Often times, Ruthie traveled on the subway with her friend Jem, and they discussed their abuses as Jem was abused also. They share many interests in life. Ruthie said thoughts of jumping across the train tracks often crossed her mind. Jem talked her down at times. One night, she came home and had me cornered in my bedroom with her eyes blazing with fire as she sat me on the bed and yelled at me, “Why didn’t you come over to my house and save me from the abuse? I was waiting for someone to save me. I can still smell the scent of Jason on me. Night after night and Sunday after Sunday, when he came home from church, he had me as his sex slave. Grandma you said you felt in your mind something was not right, so why didn’t you come and kick the door down and find out what was going on?”

“But, my dear, I did call the Children’s Aid. I told them what you said, that you were sleeping in the closet at one time, and they came and visited. They called me and told me all was good in the home. There was nothing else I could have done.”
She left that night with her friend, and three days later, I heard from her that she is in British Colombia. They took the bus. She said if she hadn’t left the province, she would have jumped the subway track. As you know, Joanna, there is a finished rooftop on my building. Many times, whenever Ruthie comes home, she would go to the rooftop even before she goes to bed. She said she finds peace and comfort there. She felt like God was up there waiting to talk and comfort her.

Is domestic work really for black women? It seems that way. Whenever some white person or others meet you and talk about work, it seems they are waiting for you to say that this is the job you are doing. 

Amazon Book LINK -https://www.amazon.co.uk/Henrietha-Joyce-M-Johnson/dp/1643617443/ref=sr_1_1?crid=1SHWMFWKGWF34&dchild=1&keywords=joyce+m+johnson&qid=1615054825&sprefix=Joyce+m+jo%2Caps%2C167&sr=8-1



Batman by Mark Antony Raines


 

I need my mum by Mark Antony Raines




 

DOCTOR-WHO-THE-SENSORITES-EPISODE 2


 

COMEDIC ESSAYS BY SHAUN ELI PERFORMED BADLY BY MARK ANTONY RAINES AKA GHOSTMAN WHO IS NOW GOING BACK TO WATCHING PAINT DRY BACKWARDS.mp3


 

GHOSTMAN HORROR DOGNAPPED BY MARK ANTONY RAINES


 

GHOSTMAN HORROR THE CONFESSION BY MARK ANTONY RAINES


 

SHAUN ELI-WWW.BRAINCHAMPAGNE.COM-THE IVY LEAGUE OF COMEDY






 Website -https://www.brainchampagne.com

The ivy league of comedy -https://www.ivystandup.com/videocast-the-ivy-league-of-comedy

YouTube -https://m.youtube.com/watch?v=_sbCkETypb4

Stand-up comedian Shaun Eli has rightfully been called one of America’s smartest comics. Whether it’s a story about dining with a vegetarian or successfully fighting a parking ticket, master storyteller Shaun Eli shows you that there’s hilarity in the ordinary if you approach life with a comedic warp. Job interviews? Serving on a NYC criminal jury? How about the Ten Commandments? For just about anything he’s experienced Shaun has a hilarious story at the ready. 

With a sense of humor that’s both cheerful and universal Shaun has headlined shows on five continents. His jokes have been quoted everywhere from the New York Post to Readers Digest to Healthcare Finance News. In both Reform Judaism magazine and the Christian Science Monitor, where he was the subject of the cover story. He’s been featured on CareerBuilder.com and CNN, in local papers like the Scarsdale Inquirer and the Asbury Park Press and in the college papers the Yale Daily News and the Daily Pennsylvanian. Even in The Journal of Irreproducible Results, a scientific humor magazine. Yes, there is one. And his group The Ivy League of Comedysm was the subject of a front-page story in the Philadelphia Inquirer.

More than just smart, funny and clever, Shaun is determined to express his opinion passionately, not surprising for someone who wrote his first satirical essay at age ten. When profiled in Fortune magazine “Tonight Show” host Jay Leno quoted one of Shaun’s jokes, citing it as an example of the type of “smart comedy” he’s happy to include in his opening monologue. Jay and other late-night hosts used Shaun’s topical material in their monologues for almost two decades.

Outside the world of comedy Shaun was a world-class athlete in two obscure sports (rowing and dragon-boat racing), worked as a lifeguard instructor and is an instrument-rated pilot. He is also an award-winning economic forecaster who once sold his car to a hitchhiker.

Shaun is a graduate of the Wharton School of the University of Pennsylvania. You can watch his videos and read some of his writings, including satirical political essays and hundreds of jokes he’s written for late-night television, on his web site BrainChampagne.com where his slogan “Brain Champagne: Clever Comedy for Smart Mindssm” rings true.

The ship id doomed


 

A-C-old-Greeting